PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta003131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 295aa    MW: 33330.8 Da    PI: 6.061
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-53151PU_refplantGDBView CDS
gnl|UG|Pta#S25657680PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1993146356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ +q++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Pta003131  93 KKRRLSVQQVRSLETSFETESKLEPERKMQLAAELGLQPRQVAVWFQNRRARWK 146
                56789************************************************9 PP

2HD-ZIP_I/II128.52.8e-4193183292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkrrls +qv++LE+sFe+e+kLeperK++la eLglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++y+++++e+++Le +v++L++e+ 
    Pta003131  93 KKRRLSVQQVRSLETSFETESKLEPERKMQLAAELGLQPRQVAVWFQNRRARWKTKQLERDYDDLKQQYEEVVAEKKKLEGQVARLTQEVV 183
                  9**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1983150IPR009057Homeodomain-like
PROSITE profilePS5007116.89288148IPR001356Homeobox domain
SMARTSM003896.0E-1791152IPR001356Homeobox domain
PfamPF000461.5E-1693146IPR001356Homeobox domain
CDDcd000867.64E-1693149No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1995155IPR009057Homeodomain-like
PRINTSPR000313.9E-6119128IPR000047Helix-turn-helix motif
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PRINTSPR000313.9E-6128144IPR000047Helix-turn-helix motif
PfamPF021838.5E-7148180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
ECYKFDGGLG NRGGFALIYT TSMSFNFGSG NEHAVNGFLH LQSGLFSRRF HANGHGHRSG  60
SGFYGSVLYD NPSSSEEVGL CDDDEISGGL HSKKRRLSVQ QVRSLETSFE TESKLEPERK  120
MQLAAELGLQ PRQVAVWFQN RRARWKTKQL ERDYDDLKQQ YEEVVAEKKK LEGQVARLTQ  180
EVVAAKGEKK DQKALISSKS EEENGLQKTT TSTTEEMQST SPSFCSDAGS NRKILLSSPS  240
RNIQAAVCKT DEENEERNLQ ALYSNDFHDQ LDMYRYLVAA EQNHHGPDWL NFENL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.11880.0cone| needle| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NYL70.0A9NYL7_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-36homeobox 3